Quick start¶
This minimal example follows the same stages as a production workflow. Replace the short demonstration sequence and molecule count with the system described by your study.
1. Build a single-chain model¶
dps pdb2dps \
-s MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDW \
-oc chain.pdb -op chain.itp -on PROT --seed 1215
The explicit seed records the model-building random state. The default is also 1215, but writing it in a workflow script makes the provenance visible.
2. Pack the simulation box¶
dps genmesh -f chain.pdb -p chain.itp -n 64 \
-mesh 4 4 4 -oc system.pdb -op system.top --seed 1215
3. Prepare a portable run input¶
Copy and edit a packaged MDP template, then validate and compile the inputs:
cp dropps/share/templates/md.mdp md.mdp
dps grompp -f system.pdb -p system.top -m md.mdp -o run.tpr
The generated TPR v2 file stores a serialized OpenMM System, coordinates, topology data, parameters, and source checksums. It is a DROPPS format rather than a GROMACS TPR.
4. Run and validate¶
dps mdrun -s run.tpr -o run
dps check -s run.tpr -f run.xtc
A production GPU run should select the platform explicitly:
dps mdrun -s run.tpr -deffnm run \
--platform CUDA -gpu_id 0 --precision mixed -cpt 10
5. Create groups and analyse¶
dps make_ndx -s run.tpr -o index.ndx
dps density -s run.tpr -f run.xtc -o density.xvg -x z
See the Command reference for the exact options of all 28 commands. For slab simulations, dps editconf can extend a compact box:
dps editconf -f compact.pdb -o slab.pdb -mz 10